PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.306690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 313aa    MW: 34706.6 Da    PI: 7.431
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.306690.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
   Cucsa.306690.1 14 KGPWSPEEDAKLKDYIQKHGTGgNWISLPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding42.81.2e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++ ++ +  G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.306690.1  69 GDFSEEEDTIICNLYTTIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.54966IPR017930Myb domain
SuperFamilySSF466893.63E-2811109IPR009057Homeodomain-like
SMARTSM007171.2E-121364IPR001005SANT/Myb domain
PfamPF002494.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-251569IPR009057Homeodomain-like
CDDcd001672.98E-91662No hitNo description
SMARTSM007178.9E-1267115IPR001005SANT/Myb domain
PROSITE profilePS5129416.33967117IPR017930Myb domain
PfamPF002491.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2470117IPR009057Homeodomain-like
CDDcd001674.53E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRTPCCDKA NVKKGPWSPE EDAKLKDYIQ KHGTGGNWIS LPQKAGLKRC GKSCRLRWLN  60
YLRPDIKHGD FSEEEDTIIC NLYTTIGSRW SVIAAQLPGR TDNDIKNYWN TKLKKKLTSP  120
HGMLPQFIQP SSTNSSSSSS SPSSYSNNGP LISTLLEPIS FSSNLLLNPT TTTTNNNATP  180
LFNHQAVSQD HQSFMMSTMV GGENNYHVKL GDQRSLLVFG GDQGSCSSSD AEYGGGIGVE  240
EKRRSLSSSN MSFVEWSRVV NGWNNNEKQL EDQGMWNNNS NMENNYSPFM DYGLEEIKQL  300
ISSSNCTTNV LF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141197110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137976.10.0PREDICTED: transcription factor RAX2
SwissprotQ9FKL24e-75MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0A0LE281e-134A0A0A0LE28_CUCSA; Uncharacterized protein
STRINGGLYMA19G36830.11e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.13e-76myb domain protein 68